SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428220322|ref|YP_007104492.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|428220322|ref|YP_007104492.1|
Domain Number - Region: 100-152
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.00863
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428220322|ref|YP_007104492.1|
Sequence length 158
Comment hypothetical protein Syn7502_00189 [Synechococcus sp. PCC 7502]
Sequence
MNLTEILEPIAQVFKNLGVPEPVVHWGHPFFMSIVIFMMGSFVGLAGWRGRLVTDTNVAL
KSRDDHRKLAPLMTAFLAAGYTGGLLSLVMQGKPLLESPHFLTGSAVLILLFTNAAISLS
GFGGNKPLLRNAHAYLGSATLALLFFHAALGLKLGLAI
Download sequence
Identical sequences K9SP51
gi|428220322|ref|YP_007104492.1| WP_015167016.1.58188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]