SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428220432|ref|YP_007104602.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428220432|ref|YP_007104602.1|
Domain Number 1 Region: 1-152
Classification Level Classification E-value
Superfamily CheY-like 4.84e-40
Family CheY-related 0.0015
Further Details:      
 
Weak hits

Sequence:  gi|428220432|ref|YP_007104602.1|
Domain Number - Region: 171-380
Classification Level Classification E-value
Superfamily PP2C-like 0.00288
Family PP2C-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428220432|ref|YP_007104602.1|
Sequence length 383
Comment serine phosphatase RsbU, regulator of sigma subunit [Synechococcus sp. PCC 7502]
Sequence
MLQVLVIDDDPVMRMILKNALQEQGYLVILAKDGQEGIDLAKKHHPALVICDWLMPKVDG
LEVCLQVKQEPSLYYTFFILLTSRSAVEDKVQALNHGADDFLSKPIDKMELIASVRAGLR
LYQLNQDLQLQKQLLVAELNEASEYVRSLLPKSLDHNVKIRTEFLPSSQLGGDCYDFYWL
DPDHLAIYLIDTSGHGVGSALLSISILNLLRSQSFGKDKFYDPKIVMTELNRAFQMSQQG
GRYFTMWYGVYQQSERKLVYANAGHPTPIVISGNHDNLKIKQLPSLSIPIGFFPDAEYTS
AELLIDRNTSLYIFSDGIFEVMQETGRIWGLANLIKLLTNELPLSQNITGQNFTAEWVRE
HIRKETPDADFSDDVSLVHINFP
Download sequence
Identical sequences K9SPE8
gi|428220432|ref|YP_007104602.1| WP_015167126.1.58188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]