SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428220816|ref|YP_007104986.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428220816|ref|YP_007104986.1|
Domain Number 1 Region: 220-371
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.49e-45
Family Pentapeptide repeats 0.00022
Further Details:      
 
Domain Number 2 Region: 26-155
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 5.73e-39
Family Pentapeptide repeats 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428220816|ref|YP_007104986.1|
Sequence length 418
Comment putative low-complexity protein [Synechococcus sp. PCC 7502]
Sequence
MANEEHLALIHKGVATWNLWRQSHPHIQDLDLSDCDFTGANLSEVDFAGTDLQKANFSGA
DLSRAKLRRATFGETNFSNTNLSEADLRRVNLSGADLRGANLSTADLIGADLRRATLEGA
ILAEADLSRTNLVGTNMTDANLSMANFTGSDLSGAIMIRADLRRANISRANLNEADISRA
DLSGVDFSGSNLSQANFEEANFLGTNFSRTNLIEANFSNTNFREVDLSGSDLIGADLSNA
NFAEADLRRANLVGANFNNANLKEADLSGAYLIGATLVNANIVRADFRRANLIGADLTGA
DLTGADLVGANLSGANLSDCNLTSVSLTSADLSMANFANCDLTNANLSRVQALSTNFSGA
MLTGANLEDWSVNSKTKLDDVECDYIYLRANQEQRLPSIGIFAPGEFTQQFMMLTDRP
Download sequence
Identical sequences K9SSF9
gi|428220816|ref|YP_007104986.1| WP_015167510.1.58188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]