SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428220821|ref|YP_007104991.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428220821|ref|YP_007104991.1|
Domain Number 1 Region: 83-352
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 6.19e-65
Family BC ATP-binding domain-like 0.00000546
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily PreATP-grasp domain 2.66e-47
Family BC N-terminal domain-like 0.0000315
Further Details:      
 
Domain Number 3 Region: 330-449
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 5.76e-38
Family BC C-terminal domain-like 0.00016
Further Details:      
 
Domain Number 4 Region: 635-761
Classification Level Classification E-value
Superfamily Cyclophilin-like 2.24e-32
Family PH0987 C-terminal domain-like 0.012
Further Details:      
 
Domain Number 5 Region: 930-1066
Classification Level Classification E-value
Superfamily Cyclophilin-like 2.09e-26
Family PH0987 C-terminal domain-like 0.0013
Further Details:      
 
Domain Number 6 Region: 1144-1217
Classification Level Classification E-value
Superfamily Single hybrid motif 4.32e-20
Family Biotinyl/lipoyl-carrier proteins and domains 0.0014
Further Details:      
 
Domain Number 7 Region: 814-906
Classification Level Classification E-value
Superfamily PH0987 N-terminal domain-like 4.84e-20
Family PH0987 N-terminal domain-like 0.0038
Further Details:      
 
Weak hits

Sequence:  gi|428220821|ref|YP_007104991.1|
Domain Number - Region: 564-657
Classification Level Classification E-value
Superfamily GAF domain-like 0.0155
Family GAF domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428220821|ref|YP_007104991.1|
Sequence length 1224
Comment urea carboxylase [Synechococcus sp. PCC 7502]
Sequence
MFSKILIANRGEIACRIIRTCDRLGISTVAVYSEADTYSLHVSMARESVAIGGALASESY
LRWERILEAAKQTGAEAIHPGYGFLSENAEFAEACAREGIIFIAPTPEQMRSFGLKHTAR
ELAEQNQVPLLPGTGLLGSVEEALTAAEQIGYPVMLKSSAGGGGIGLQLCRSQEQLPQLY
ATVQRLSQNNFKQSAIYLERFVETARHIEVQIFGDGEGRVLALGDRDCSVQRRNQKVIEE
TPAPEITHEQRQELYEAALRLGRSVNYQSAGTVEFVFDCDRQEFYFLEVNTRLQVEHGVT
ETVTGVDLVEWMIRLAAGDSSFFDTYQHSPQGHSIQVRIYAEDPTKNFQPSSGILTDVRF
PEEIFNEGKEIRCDRWIERGTEVTPYYDPLLAKLIVYGETRTEAITQMQSALAHSQIAGI
ETNLDYLRQILADPRFASGNLNTRFLNSFAYLPQTIDVLAAGTFTTVQDYPGRVGYWNIG
VPPSGAMDTLALRYGNRLVGNIESAAGLEFTINGATLRFNTDTIICLTGARMEAEIDGNS
IPFWQAISVSRGSILKIKGIIGNGLRAYLTVRNGIDVPDYLGSKSTFTLGKFGGHCGRIL
RVGDVLKLNSINNPDQAIAPSSLSSNLIPVYPEHWEIGVLYGPHGAPDFFTPEDIEMFFS
TDWEVHYNSARTGIRLIGPKPQWARKDGGEAGLHPSNIHDNAYAIGAIDFTGDMPIILAV
DGPSLGGFVCPATIALGEIWKIGQLKPGNTVRFIRITHEQALQLKSQQDQEITTLQAVKT
KSIPLSSPFLNLNSLNTEAVLHKIDGSNDQIAVKYRRSGDDNILIEYGEMVLDLNLRFRV
HALMSWLEAHPLAGILDLTPGIRSLQIHYDHRLLSLERLLETLINAESELPAIADMEVPT
RIVYLPLSWDDPSTQLAIEKYVRSVNPKAPWCPSNIEFIRRINGLESIEAVQEIIFNASY
LVLGLGDVYLGAPVATPIDPRHRLVTTKYNPARTWTPENAVGIGGAYMCVYGMEGPGGYQ
FFGRTIQMWNTYRYDSSQTEDFEAGKPWLLRFFDQIRFYPVSEAELLQHRRDFIHGRFKL
RIEHETFSLSKYNEFLAAIAPEAAAFKANQQAAFEAERERWIADDLLMDENTSAEVPSDQ
TSIDLPPNSELVVSHIPANVWQILVKKGEEVKVGDRLMILESMKMEMNIVADVAGTVIDL
LCTEGEMVSVGQGLCIIQATNLSK
Download sequence
Identical sequences K9SSG2
gi|428220821|ref|YP_007104991.1| WP_015167515.1.58188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]