SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428220955|ref|YP_007105125.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428220955|ref|YP_007105125.1|
Domain Number 1 Region: 85-214
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.28e-32
Family Pentapeptide repeats 0.00038
Further Details:      
 
Domain Number 2 Region: 31-83
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.000000000000687
Family Pentapeptide repeats 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428220955|ref|YP_007105125.1|
Sequence length 244
Comment putative low-complexity protein [Synechococcus sp. PCC 7502]
Sequence
MANLQQLQLLAEGVDSWNQWRKNFPDTPILLQNAMLSVANLRYANLSHANLEGADLYHTN
LIEANLEYANLAGASLNGAIATGSLIYADLSLANLYSSAFTFANLSQANLQGSSAIAANF
NSANLQGANLQDINASHAIFWQTNLSDVDLSRAILWSAKLYCADLRRSLLQDADLSGADL
SGADLRDADLSGADLRDANLSRTNLEGANLDDIRWGKDGRGNATNWRNVVGLMSAHNVPA
ALLQ
Download sequence
Identical sequences K9SS70
gi|428220955|ref|YP_007105125.1| WP_015167649.1.58188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]