SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428220973|ref|YP_007105143.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428220973|ref|YP_007105143.1|
Domain Number 1 Region: 1-236
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.1e-71
Family Cytidylytransferase 0.0083
Further Details:      
 
Domain Number 2 Region: 247-434
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 1.47e-31
Family gamma-carbonic anhydrase-like 0.014
Further Details:      
 
Domain Number 3 Region: 637-741
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 0.0000000000000192
Family Phosphoglucomutase, first 3 domains 0.012
Further Details:      
 
Domain Number 4 Region: 533-633
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 0.00000000114
Family Phosphoglucomutase, first 3 domains 0.0029
Further Details:      
 
Domain Number 5 Region: 746-830
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 0.0000000131
Family Phosphoglucomutase, C-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428220973|ref|YP_007105143.1|
Sequence length 850
Comment Nucleoside-diphosphate-sugar pyrophosphorylase family protein [Synechococcus sp. PCC 7502]
Sequence
MRAVLMAGGTGTRLRPLTCDLPKPMVPILNRPITEHIINLLKRHGILEIIATLHYLPDVI
RDYFSDGSDFDVKMRYVVEEEQPLGTAGCVKNVEGLLDQTFLVISGDSITDFDLTAAIKF
HRDKRSQATLILHRVKEPMAFGVVITDEEYRIQRFLEKPSTSEVFSDTVNTGIYILEPEV
LQYLEPNTPSDFSQDLFPILLERSVPMFGYVAEGYWCDVGSLETYRQSQYDAIRGRVFLD
LSYGQQRTGVYVGHNTFIDPSVQIEPPVMIGNNCSIAARVTISAGTIIGDHVTIGANSDL
QRPIIGNSVIIGEECHIWACVIARNARISRRSQVMEGAVVGSGCVIEEEVRICPNVRIWP
SKKVETGTILTHNLIWGITVSRNLFGHRGVSGLANVEIIPEFAVKLGAAYGATLRPGAQV
MVSRDQRPICRMVTRSLISGLMSVGVNIQNLEATAIPISRFIAPTLGVVGGVHVRIHPDR
HDHVLIEFLDSNGINISKPQEKKIESTYFKEDFRRARIEEIGEISYPSRIVDYYNSGFSQ
NLNIDTIRYSACKKVVIDYVYAVSGAVLPRILGKFGSEVIVLNASLNQIAPPMSERHRLL
TQLSDVVTALKANFGVQVSANGERLILIDDTGYPIQGELLTAVLMEMALTAYPTGSVVVP
VSVSGVIDEIAAKHQGKVIRTKSNPTEVMLTCSKEKNVALGGCAEMGFIFPKLHCGFDAM
FAIAKIIEWITVQERTISQVRLDLPKFHYDTNVIKCPWSVKGSLMRHLVESHNQNPLDLT
DGVKIFYENHNWVLILPDAGDPVINLYVNSNNYSDQQNWVQQQMQEFSEYIDSFCKMQVA
LSKDSSLLDN
Download sequence
Identical sequences K9SRZ0
WP_015167667.1.58188 gi|428220973|ref|YP_007105143.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]