SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428220989|ref|YP_007105159.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428220989|ref|YP_007105159.1|
Domain Number 1 Region: 132-315
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 7.28e-50
Family ATP-binding domain of peptide synthetases 0.0000301
Further Details:      
 
Domain Number 2 Region: 1-129
Classification Level Classification E-value
Superfamily PreATP-grasp domain 4.6e-33
Family Prokaryotic glutathione synthetase, N-terminal domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428220989|ref|YP_007105159.1|
Sequence length 324
Comment glutathione synthetase [Synechococcus sp. PCC 7502]
Sequence
MKLAFIIDPIHKLDPTHDTSVALMEAACGQGHQVFVTSKESLSIVNGKAQAFLEPVHIYP
VELINGKWNTQTPWYQEDLGSYQPLGNMQVVWMRPDPPVTVEYIYATYILDYVDPSRTLV
VNSPKGIRSANEKVYALQFSCTPETIVSSSKSTIKEFIQAKGEAVIKPLDGKGGEGILFA
TVGDRNLNSLIEISTKFGKVPVMVQAYLPAAQAGDKRIILLNGEPIGAVNRIPSSGEFRG
NMAAGGSVAKIEITPRELEICRELSPVLQKDGLIFVGIDVIGGYLTEVNVTSPTGIREID
RLNGTRLADQVITWLGERSTYGSN
Download sequence
Identical sequences K9STA5
WP_015167683.1.58188 gi|428220989|ref|YP_007105159.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]