SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428221255|ref|YP_007105425.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428221255|ref|YP_007105425.1|
Domain Number 1 Region: 270-479
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 2.22e-39
Family Protein prenylyltransferase 0.0073
Further Details:      
 
Domain Number 2 Region: 7-230
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.07e-34
Family Prokaryotic proteases 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428221255|ref|YP_007105425.1|
Sequence length 504
Comment hypothetical protein Syn7502_01187 [Synechococcus sp. PCC 7502]
Sequence
MRIKPYLCTLILLHGITFTSFLRSAWGMSATEVGKVAKAVTVMITTDESNGSGVLITKDG
DTYTVLTAAHVVKDRPKSLEIITPNGQKYAITGTTITPDADLATVKFTSKTSLQVAKLGD
ANKSSEGATVYVSGFPSVTQVITKTIYNFTEGKVTANAARPLSYGYSLVYSNNTLPGMSG
GPVFNADGELIAIHGRGDFQESSKPSEINENVRIKTGFNLGITISTVLKLSNGLGLKFSE
VALGSSPVVAAPKSDDFFLQGVDRFRRGKWAEAIAMMDRAIQLNPKYLRAYTARGAANYM
LNQIGKGLADMESVIAIAPNYATGYAGKCFLLNELHQWQQALGFCDRAIKLDPKLSIAYN
VRGLVNANLQDSDSAQTDLEQAIDLDPNSYYAYYNLGLLYALRRNLPKAFSFVEKALQIN
PQSAGSRVLLGQLLIATQNYQQALTILNEAIAINPNISYAYEARAAAYLGLGNTNLAQRD
RQTAQSTAISSPQGFIEDLSFLNQ
Download sequence
Identical sequences K9ST29
WP_015167949.1.58188 gi|428221255|ref|YP_007105425.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]