SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428221261|ref|YP_007105431.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428221261|ref|YP_007105431.1|
Domain Number 1 Region: 1-208
Classification Level Classification E-value
Superfamily Formyltransferase 5.1e-63
Family Formyltransferase 0.00000217
Further Details:      
 
Domain Number 2 Region: 206-305
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 6.28e-27
Family Post formyltransferase domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428221261|ref|YP_007105431.1|
Sequence length 312
Comment methionyl-tRNA formyltransferase [Synechococcus sp. PCC 7502]
Sequence
MRVVFFGTPDFAVPTLQRLLNSPDFEVIGVVTQPDAKRGRGNQTTPSPVKAIALAHNPNI
PIWTPERIKKDTETLATLANSQADVFVVVAYGQILSQAILDMPKQGCINVHGSLLPKYRG
AAPIQWAIANGETTVGITTMQMDAGIDTGDMLLKASLEVALEDQAESVSQKLAVLGADLL
IETLQNLEQITPTPQDHSQFTYAPTISKELWQIDWSKSAIAIHNQIRGFYPNCYTTLRNQ
RLKIMTTQVSSMYNIPNPPGTIYYIEKNIGFTVCTGDGLLLIKEVQPAGKRSQSAKEFLN
GNQWLKNGDILG
Download sequence
Identical sequences K9STR0
gi|428221261|ref|YP_007105431.1| WP_015167955.1.58188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]