SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428221291|ref|YP_007105461.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428221291|ref|YP_007105461.1|
Domain Number 1 Region: 43-504
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 3.79e-163
Family Type II DNA topoisomerase 0.000000000988
Further Details:      
 
Domain Number 2 Region: 537-782
Classification Level Classification E-value
Superfamily GyrA/ParC C-terminal domain-like 1.96e-46
Family GyrA/ParC C-terminal domain-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428221291|ref|YP_007105461.1|
Sequence length 837
Comment type IIA topoisomerase subunit A [Synechococcus sp. PCC 7502]
Sequence
MTNRGQQLNFLTSPEPSAGRVISVSLHTEMQQSYLEYAMSVIVGRALPDVRDGLKPVHRR
IIFAMHELGLVPERPYRKSARVVGDVLGKYHPHGDQSVYDALVRLVQDFSSRYPLLGGHG
NFGSVDNDPAAAMRYTECRLAPIGNEVLLSDINEAVIDFAPNFDGSQMEPTVLPAQLPML
LLNGASGIAVGMATNIPPHNLAEVVDGMIALIDRPDLEDEKLFELIPAPDFPTGGIIVEN
TGVRELYSTGRGSITVRGVHSLETVIGKNKRSRQAIIVTELPFQVNKSAWIEKIAELVNH
GKIEGIDDLRDESDRTGMRVVLELKKDVTADGVLEQLYRQTALQSNFGGSMLALCGSMPK
QLTLRQLLEEFLAFREETLTRRYRHELQEAQSRLHLVEGLVSAIENLDALISLLRFAATN
AIAKTELQAQFNFSVVQAEAILSMPLRRITAMEQSGLQAEMTELKTQIASLEVYLGDRRE
LLKNIKKELRQLKKKHGDNRRTRLLSLSNGISNGQISPANPDPKLPEITPVEPPQPALIQ
LTQKGYIKRLEPKSKNGSSSANSSADDIVIADYHTSTDQDLIVLTNSGKAFPVAIADIPK
GKPKGTPLIRLLPDSAEPVVSHFVWDRQPEASIVLVTAEAKIKRLSLSELGGISSRGLIT
IKLGEQDQLFWGGIVSLDQQIAVATSTGRILRMNTDESQVSILGRSAMGTMALRLRNSET
LIGVIPLATDLELLLITAQGYAKRLKAQDIRLSSRASIGSQSIMFKNKEDSLAAIAPILP
NQAHIHLGISRDDHQSKIGEKIVELELVRIPLEPCNSSGLKIPELEISRLHSVKIYN
Download sequence
Identical sequences K9STT5
gi|428221291|ref|YP_007105461.1| WP_015167985.1.58188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]