SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428221329|ref|YP_007105499.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428221329|ref|YP_007105499.1|
Domain Number 1 Region: 167-436
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.36e-70
Family Extended AAA-ATPase domain 0.0000000546
Further Details:      
 
Domain Number 2 Region: 423-613
Classification Level Classification E-value
Superfamily FtsH protease domain-like 1.83e-65
Family FtsH protease domain-like 0.00000332
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428221329|ref|YP_007105499.1|
Sequence length 618
Comment ATP-dependent metalloprotease FtsH [Synechococcus sp. PCC 7502]
Sequence
MAIKNEDPKSTRSRIIGNVLLLVGGGLLLLNFLFPLFVAPQVAQVPYSLFIHQVQAHQVA
RASIGQNQITYQLKENDPANPSSILTTTPIFDLELPKVLQENGVEFAAAPVKNNNSWFGT
LISWVIPPLIFVGIFQLFGRFGGGAGGAGLQIGKSKAKAYVPGNSSKVLFNDVAGVDEAK
TELVEVVEFLKTPEKFTRIGAKIPKGVLLVGPPGTGKTLLAKAVAGEAGVPFFSISGSEF
VELFVGVGSSRVRDLFEQAKKQSPCIVFIDELDAIGKSRSNNSMFGGNDEREQTLNQLLT
EMDGFTDDGTTVIVLAATNRPETLDPALLRPGRFDRQVLVDRPDKIGREAILQIHAKKVV
LDPEVDLKLIATRTSGFAGADLANLVNEAALLAAREGRNAVKTKDFAEAVERVVAGLEKK
SRVLNDHEKKIVAYHEVGHALVGALTPGSGKVEKISIIPRGMAALGYTLQVPTEDRFLLS
KEEIQAQIATLLGGRSAEEVIFGSITTGAANDLQRATELAEQMVTSYGMSSVLGPLAYQK
KNNDFLGGGMNGGRSLSANTSELIDQEIKDIVEKAHDRALAILNHNRSLLESISEKLLES
EVIEGDLLQSYLTQVVAP
Download sequence
Identical sequences K9SUB5
gi|428221329|ref|YP_007105499.1| WP_015168022.1.58188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]