SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428221373|ref|YP_007105543.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428221373|ref|YP_007105543.1|
Domain Number 1 Region: 564-934
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.22e-86
Family Quinoprotein alcohol dehydrogenase-like 0.019
Further Details:      
 
Domain Number 2 Region: 859-1155
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 4.32e-76
Family Quinoprotein alcohol dehydrogenase-like 0.032
Further Details:      
 
Domain Number 3 Region: 103-364
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.85e-34
Family Extended AAA-ATPase domain 0.065
Further Details:      
 
Domain Number 4 Region: 516-554
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000314
Family Pentapeptide repeats 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428221373|ref|YP_007105543.1|
Sequence length 1182
Comment WD40 repeat-containing protein [Synechococcus sp. PCC 7502]
Sequence
MRIGEAIALVEQLLERGRLTKVQEIVFRQTWEGQTYLNISVNAGYDPSYIKDVGSELWRS
LSTALNEKVTKSNIHGVLKRYAERQKDKNVSLPVNSAHQNISWGEAIDISQFYGRKAELQ
KLNQWIERDRSRVVTILGIGGIGKTALSLKLAEQLQGEFEYVIWRSLRNAPIFELLLAEI
IALLSKQQEIQIAPTTHIPRLIHYLQQHRCLLILDNVESILLSAKPRQYLEGYEAYGDLF
REVSERSHQSCVLLTSREQIEEVAILAGESLPIRVLPLRGLAIAEGMAILEDKGLPLTMD
KGQQLIDLYAGNPLALKIISTSILELFDGQISEFFNQGAAVFNGIRKLLDRQLDRLSDVE
KQIMFGLAINREWVSVVELQGDFSPTISTPRLLESLEYLQGRSLIEKNKGKFTQQPVVME
YMIEKLLTAVRTEISNQTPQLFLRYALIKAQAKDYVRESQIRMIMQPLLVMLQEDLGGEQ
AIALTIKQILQNLSSNSSSATSYGAGNCLNLLCHLQADLTGLDVSGLSIRQADLRDVSLH
QVNLSHANLATSMFAEAIGEIHKIVVSPDDRLVANSCNDGSISIWQVGSGQNVLNLKAHD
SYVIGLVFTPDSRRLISGSFDKHIKIWDISTGECLESWQSSADIYGIALSSDGKILAYSG
EDGSILLWDLATKRLLQKLTGHTAQVRDIAFQPYGTLLASSSFDLTIKIWDLTTGECIET
LIGHTQVVWSLSFNAEGTKLVSGSFDQLMKVWDVQTASCIQTIQAHTAVISGVIFSPDDQ
LIISGSFDSTIKFWEIAPQDNWQCSRVLQRLNNIGAIALDSTGKILISGDYGGELKFWDV
ESGQALRTLNSIPKAFKTLAFHSEGNLLASSGDDRKIRLWDITSNQCLSTITGHAMSIWR
IVFPPQGNIIASCSTDGTLKLWNVVNNNHIQELPPPLQKDFAFIVAIAFHEDILASGSSD
AMIRLWNYRTRELVQSFMTVQGSIIVNLDFHPQGHLLASACHDSTDLRVWDIKTGTCHQT
LQGHSSHIWSVDFHPQGEILASGSEDKTIRLWHIETGECLQVLKGHASTINAVKFSPDGA
YLSSSSNDLTIRIWEVATGECIRILEGHIGSVTGIAYDPAQLHQLASCSYDDTIRLWNTD
TGECLKVLRPQRIYEGMNITGATGITSAQQATLKGLGAVEIT
Download sequence
Identical sequences K9ST50
WP_015168066.1.58188 gi|428221373|ref|YP_007105543.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]