SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428221427|ref|YP_007105597.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428221427|ref|YP_007105597.1|
Domain Number 1 Region: 128-401
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 6.01e-105
Family BC ATP-binding domain-like 0.0000000099
Further Details:      
 
Domain Number 2 Region: 680-948
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.7e-100
Family BC ATP-binding domain-like 0.000000244
Further Details:      
 
Domain Number 3 Region: 396-553
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 1.83e-52
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.0000779
Further Details:      
 
Domain Number 4 Region: 1-127
Classification Level Classification E-value
Superfamily PreATP-grasp domain 2.88e-48
Family BC N-terminal domain-like 0.00000255
Further Details:      
 
Domain Number 5 Region: 556-682
Classification Level Classification E-value
Superfamily PreATP-grasp domain 3.17e-46
Family BC N-terminal domain-like 0.00000322
Further Details:      
 
Domain Number 6 Region: 951-1084
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 1.7e-36
Family Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428221427|ref|YP_007105597.1|
Sequence length 1085
Comment carbamoyl-phosphate synthase large subunit [Synechococcus sp. PCC 7502]
Sequence
MPRRNDIHKILLIGAGPIVIGQACEFDYSGTQACKALRDEGYYVILVNSNPATIMTDPVT
ADRTYIEPITPEIVAQIIEKERPDALLPTMGGQTALNTAVALAKNGTLEKYGVELIGAKL
PAIEMAEDRKLFKEAMARVGVAVCPSGLGHTMAEAREIAAEIGTYPLIIRPAFTMGGTGG
GIAYNQEEFEMIAASGLEASPNSQILIEKSLIGWKEYELEVMRDLADNVVIICSIENIDA
MGIHTGDSITVAPAQTLTDKEYQRLRDYSIKIIREIGVETGGSNIQFAINPVNGEVVVIE
MNPRVSRSSALASKATGFPIAKFAAKLAVGYTLDEIPNDITKKTPASFEPTIDYVVTKIP
RFAFEKFPGSQAVLTTQMKSVGEAMAIGRTFQESFQKALRSLETGRFGFGGDKDEVIPTL
EQIKTSLRTPNPDRIFSVRHGFLSGLSVGAIATLTHIDPWFLQKLRELTDIELALKDRSL
SDIPVEELTEVKRMGFSDRQIAYLTHSTEDEVRTYRKSLGIIPSYKTVDTCAAEFEALTP
YHYSTYEEESEVLPSEKRKVMILGGGPNRIGQGIEFDYCCCHASYSLRAAGFETIMVNSN
PETVSTDYDTSDRLYFEPLTREDVLNIIEAEQPEGIIIQFGGQTPLKLSVSLQKYLNEHQ
DTLKTKIWGTSPDSIDTAEDRERFEAICQELGIKQPNNGLARSYAEALEVAQRVGYPVVV
RPSYVLGGRGMEVVYSDAALEEYMHKAILIEPEHPILIDQFLEGAIEVDVDAISDPTGQV
VIGGIMEHIEEAGIHSGDSACAIPTFSLSEDVLTTIREWTVKLAKSLKVVGLMNIQFAVQ
VNPNNPKQEQVFILEANPRASRTVPYVSKATGVPLVSYASQIMSGKTLDELRFTKEVIPT
HISIKEAVLPFAKFAGTDIILGPEMRSTGEVMGIDTEFGKAFAKAQIAAGERVPLAGTVF
ISVNDRDKAGVTAVAEGFIELGFKIIATEGTHKILLRKGIDSELVLKVHEGRPNISDVIK
NSQVQIIINSPSGEDASLDGKLIRRSALSYKIPVITTLAGAKAAIAAIRSLQTQPLQVQA
LQDYA
Download sequence
Identical sequences K9SS65
gi|428221427|ref|YP_007105597.1| WP_015168120.1.58188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]