SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428221482|ref|YP_007105652.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428221482|ref|YP_007105652.1|
Domain Number 1 Region: 1094-1340
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.79e-79
Family WD40-repeat 0.0000376
Further Details:      
 
Domain Number 2 Region: 758-1051
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.06e-78
Family Quinoprotein alcohol dehydrogenase-like 0.021
Further Details:      
 
Domain Number 3 Region: 104-279
Classification Level Classification E-value
Superfamily Nucleotide cyclase 3.3e-43
Family Adenylyl and guanylyl cyclase catalytic domain 0.0016
Further Details:      
 
Domain Number 4 Region: 302-572
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.27e-36
Family Nitrogenase iron protein-like 0.045
Further Details:      
 
Domain Number 5 Region: 713-756
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.000000785
Family Pentapeptide repeats 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428221482|ref|YP_007105652.1|
Sequence length 1375
Comment WD40 repeat-containing protein [Synechococcus sp. PCC 7502]
Sequence
MSNSLKASLEGLEIINRARLRHGWTKTRSAAWWMKADVSQITLRRFWSGEKVRRDNFIAI
CDAVGIKDWQAIAVPVEELIAEIYESTISAKVSMAKEISLTETKRNLAAIVFTDIQGFTA
HLENHEEQALTAIARDFQMMTDICQSFEGQVLKSTGDGLLLYFTSAIAAVACALEIQESL
VKFSETISDSISELILAHRIGIHLGDVFFSDGDVMGNGVNIASRIQNEAEPGGICISQTV
YDVVKHTLSLKANYLGARELKNISEAVPIYEILLVSQEARARNREQVKLSTTKLRADIKQ
VFHQSQDWGEAPDVSDFYGRDREISQLESWIINDRHKLIAILGMGGIGKTTIAVAVADQV
STHFDCLIWRSLRNAPPVDQLLSDLLLSLSTEQLNETEGFDQKLSRVTRYIQDRRCLLVL
DNLESILSEDERGRYRSGYEGYAELVRCFAETRHQGCLVFTGREPPLELSRFNSARSLLL
SGVSDADGKRICNQIAALDASEREWHQIITHYGGNPLALKIVVAGIRDLLGGDVRQFLEL
LSQGILGFRDIQDVLSRQFDRISIYEREAMYWLAIAREPISFKELHEDLVSLGSRQKLLD
TLESLQRRSLLETSHNCFNLQPVVMEYVTNYLVEEVSQELSQGFKAWVLFRSHALIKASA
PDYIREIQVRFILNPIIDRIGNDYLGELLLQLKAGSKKDYAAGNLLNLLVQAGTDLTNYD
FSDLTIWQAYLRDVNLHSTNFRNSNLTQSTFRETFLNIISLLFSANGEFLATGDSHGQIG
LWQVSNGKRILEIDGHTDIVFALALATDGKYLVSGSLDQTVKLWNLQTGNCESTLLDQTG
GISMLVLSPDNHYLACSCGDRYIRVLDLLERRVIHTLSGHTNIPRAIAFDPHRPILASCG
LDSTIRVWDLKTGVCLQVIADESELYTLAFSADGKLLATGGENGVIKFWSTHTWTCLNTL
TGHSDRLWSISFSLDGRFLASAGDDLSVRIWDVETGVCLRNWLAHQSRIWSLAFSPNSLI
LASGSEDKSIKFWHPETGHCLRKLQGCSNEISPFAFKGNNLYLLSGVDGQNIQVWNINTG
KCEKRIPTHNAFQASLSPDCRLLASASLDNLIRIFAVETGNLIKTLTGHTIWVRETVFNP
NGDLVASASGDKTAKLWDVQTGQCLHTLIGHSAPLQAIAFSPNGNILATGAWDAAIGIWD
AQSGECLRMLRGHNDRIAVVSFHPNSNILASGSRDSTIRLWNIHTGECILIVPHLSVKLH
ALAIHPSGNILASSGLDTAVRLWDVQTGKLLHSLDCSTKIKWIWSVVFSEDGRLLATGSE
DGLCQIWDVNTATCIQTIKISRPYEGMNIYGVRGVTEAQISVLRELGAIEDYFKG
Download sequence
Identical sequences K9SSB4
WP_015168175.1.58188 gi|428221482|ref|YP_007105652.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]