SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428221666|ref|YP_007105836.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428221666|ref|YP_007105836.1|
Domain Number 1 Region: 1-24
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 0.00000189
Family Ribosomal protein L32p 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428221666|ref|YP_007105836.1|
Sequence length 59
Comment 50S ribosomal protein L32 [Synechococcus sp. PCC 7502]
Sequence
MAVPKKRTSKSKRDIRKAAWKRKAAVSAAKALSLGKSILTGNNTGFIYPQPDAEEETEE
Download sequence
Identical sequences K9SUS5
WP_015168359.1.58188 gi|428221666|ref|YP_007105836.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]