SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428221813|ref|YP_007105983.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428221813|ref|YP_007105983.1|
Domain Number 1 Region: 11-137
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.68e-45
Family Translational machinery components 0.0000616
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428221813|ref|YP_007105983.1|
Sequence length 137
Comment 30S ribosomal protein S9 [Synechococcus sp. PCC 7502]
Sequence
MQATDQSNRAVYWGTGRRKTAVARVRLVPGSGTITVNGKPGDLYLQFNASYISGVKAPLE
TLGLENEYDVIVNAHGGGVTGQADAIKLGVARALCELSPENRKPLKVEGYLTRDPRAKER
KKYGLRKARKAPQYSKR
Download sequence
Identical sequences K9SUG1
WP_015168505.1.58188 gi|428221813|ref|YP_007105983.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]