SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428221893|ref|YP_007106063.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428221893|ref|YP_007106063.1|
Domain Number 1 Region: 301-502
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.44e-50
Family Multidrug efflux transporter AcrB transmembrane domain 0.00000538
Further Details:      
 
Domain Number 2 Region: 822-1052
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 2.75e-47
Family Multidrug efflux transporter AcrB transmembrane domain 0.00000703
Further Details:      
 
Domain Number 3 Region: 140-186,279-335
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 2.93e-25
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0013
Further Details:      
 
Domain Number 4 Region: 567-683
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 6.28e-25
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00052
Further Details:      
 
Domain Number 5 Region: 42-133
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 3.03e-24
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00019
Further Details:      
 
Domain Number 6 Region: 739-824
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 1.44e-23
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00026
Further Details:      
 
Domain Number 7 Region: 187-277
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 7.85e-23
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428221893|ref|YP_007106063.1|
Sequence length 1067
Comment hydrophobe/amphiphile efflux-1 (HAE1) family transporter [Synechococcus sp. PCC 7502]
Sequence
MILSISSFFIRRPVFATVCSLIITLLGTACIFLLPIAQYPEIAPTKVTVSSNYVGANAEV
VESTVTNILERELNGIEGVRYITSTSANNGSSSIDLVFNLGKNKDIAAVDVQNRVSTVQS
QLPGPVQQTGVTISKESTGFLFAIGVYSEKGEFDDLYLSNYADLYIVDAIKKVKGVGGVI
IFGERKYAMRIWLDPSRLAARGLTSQDVVSAIQQQNLQVGVGQIGQQPNLPDQQYQLSIS
ATGRLKDPDEFGDIVIKTATDGTLIKLKDVGRVELGAENYGSSLRFNGTRGIGLGVSQLP
DANALDVAKAVKQALKELEPNFPPGLNYEIAFDTTSFIEAGTEEVILSLLIAIGLVILII
FIFLQNWRSTLIPAIAIPVSLVGTFIFIKLLNFNINTLTLFGLTLATGLVVDDAIVVVED
ITRRIQEKGENPIQAAIHSMQELQGAVVASSLVLIAVFVPVAFFPGTTGQLYKQFALTIA
FSITVSTFNALTLSPSLAGLLLKQEATPSNWAFDRINWVIDRIRQFYQWGVRQLTKFKGV
VIILFMASLALTYWVYTIVPRGFLPPEDQGYFITIVQAPEGVSLNYTEKVLEQIEGIMRQ
KDDKGEPLYPEIANIFAVGGFSFSGNTPNNGIVFSTLKPWKERKRSADQIIGGFVPAPFG
LLPQLISIKEAFVIPFPPPAIQGLSNFGGFEFQLQDKINQGFPAIEQTLGAFLGKASTYP
DPSRPMLAGLRPNFNGNTPQLSVEVDRVKATALQVSLSDIYSTLQTLLGSQYINDFNAFG
RTYRVYVQADARFRANPEDINRLYVRSQTGQMIPLSNLVNVKQTIGPSIITHYNLLRSVQ
ITGNTAPGVSSGQAIEVMSKVAKETLPKTFGYEWSGLSLEEIESGGSAIFIFGLGVVFVF
LVLAAQYENYIDPVIIMLTVPLAVLGALSAVFLRSFFNPSFANDIYTQIGLVMLVGIASK
NAILIVEFANQLREKGLSITKAVTEAAQQRLRPILMTAFATIIGIFPLAIATGAGAAARQ
SLGTAVLGGMCVATFLSLFIVPVLYIVIKNIEERNFLKPHKVEEEPQ
Download sequence
Identical sequences K9SUN8
WP_015168585.1.58188 gi|428221893|ref|YP_007106063.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]