SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428221913|ref|YP_007106083.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428221913|ref|YP_007106083.1|
Domain Number 1 Region: 14-240
Classification Level Classification E-value
Superfamily Undecaprenyl diphosphate synthase 1.7e-88
Family Undecaprenyl diphosphate synthase 0.00000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428221913|ref|YP_007106083.1|
Sequence length 247
Comment undecaprenyl diphosphate synthase [Synechococcus sp. PCC 7502]
Sequence
MTAKLLHTLPSDLDQARLPRHVAVIMDGNGRWARQKGLPRIIGHRQGVDALKDLLRCCKD
WGIKALTAYAFSTENWGRPTEEVDFLMILFERILRRELAEMCREGVRITFVGDLASLPTS
LQAEIKESMAATVNNQSIHFTVAINYGSRHEIIKVCRQLAQAVQIGEIKLEQIDEALFQQ
HLYTSGEIDPDFLIRTSGEMRLSNFLLWQIAYTEIYFTPTLWPDFDRSEFHQALLDYQGR
DRRFGKA
Download sequence
Identical sequences K9SUQ9
gi|428221913|ref|YP_007106083.1| WP_015168605.1.58188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]