SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428221915|ref|YP_007106085.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428221915|ref|YP_007106085.1|
Domain Number 1 Region: 41-307
Classification Level Classification E-value
Superfamily PLP-binding barrel 2.62e-73
Family Alanine racemase-like, N-terminal domain 0.00000668
Further Details:      
 
Domain Number 2 Region: 282-441
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 3.35e-48
Family Eukaryotic ODC-like 0.0000338
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428221915|ref|YP_007106085.1|
Sequence length 445
Comment diaminopimelate decarboxylase [Synechococcus sp. PCC 7502]
Sequence
MAPFDQRSPNQQLLPLTAKTNANDHLEIGGCDVVELVEQYGSPLYILDELSLRTACQQYR
DGFKSYYHGESQVIYASKAWNCLAICAIVASEGLGIDVVSGGELYTALQAGVKPDVIYLH
GNNKSESELEYAIATGCTVIIDNWLELKNASNLAQSLGKSPRIMLRITPGIECHTHEYIQ
TGHLDSKFGFDPTEVESVFAFLSNQTLLQCVGIHAHIGSQIFELQPHQDLGAVMISWFKI
ASNYGLNLTELNIGGGLGISYTESDDPPSITEWVKTVSNSVITACEAQGLALPKLISEPG
RSLIGTACVTAYTIGSNKTVPQGRTYITIDGGMSDNPRPITYQSKYLAMVANHMSTEADQ
VITIAGKHCESGDILIKDIKLPKTNPGDILVVPATGAYNYSMASNYNRIPKLAAVLVDAG
TANLILKRETYADLIRQDVLPTKLQ
Download sequence
Identical sequences K9SUW5
WP_015168607.1.58188 gi|428221915|ref|YP_007106085.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]