SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428221920|ref|YP_007106090.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428221920|ref|YP_007106090.1|
Domain Number 1 Region: 30-116
Classification Level Classification E-value
Superfamily PCD-like 2.35e-29
Family PCD-like 0.00017
Further Details:      
 
Weak hits

Sequence:  gi|428221920|ref|YP_007106090.1|
Domain Number - Region: 4-40
Classification Level Classification E-value
Superfamily MCP/YpsA-like 0.0215
Family MoCo carrier protein-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428221920|ref|YP_007106090.1|
Sequence length 117
Comment pterin-4a-carbinolamine dehydratase [Synechococcus sp. PCC 7502]
Sequence
MRRRILLSGLAVTGLMGATANGANANNGKLNPQQLAQIVPQGWQVIAGKKLSREFKFKDF
VQAFGFMTKVGIAAEKLEHHPEWLNIYNSVSIDLTTHDAGGITSLDIELATKINALL
Download sequence
Identical sequences K9SUW9
gi|428221920|ref|YP_007106090.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]