SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428222224|ref|YP_007106394.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428222224|ref|YP_007106394.1|
Domain Number 1 Region: 1-419
Classification Level Classification E-value
Superfamily L-aspartase-like 1.49e-124
Family L-aspartase/fumarase 0.00000000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428222224|ref|YP_007106394.1|
Sequence length 422
Comment adenylosuccinate lyase [Synechococcus sp. PCC 7502]
Sequence
MGSLWSEQHKYQTWLEVEIAVVEAQAELGYIPSEAVAEIKAKANFDPKRVDELEAEVRHD
MIAFLTNVNEYVGEAGRFIHLGLTSSDVLDTALALQLTSSMNLILAQVETLSQAIRYQAQ
QHRYTVMAGRTHGIHAEPITFGFKLAGWLAETLRHRDRLVNTAKNIAVGKISGAVGTYAN
VDPKIEAIACQKLGLKPDCASTQVISRDRHGEFVQALALLGSSIERFAVEIRNLQRTDVL
EVEEFFAKGQKGSSAMPHKRNPIRSERLTGMARLLRGYAGTALENIALWHERDISHSAAE
RVILPDACIITHFMLSEITDLIKNLLVYPHNMQRNLNCYGGVVFSQKVLLALIDKGLSRE
ASYAIVQTSAHQAWNRSDGDFRSLIQNNPQVKDLLTPAELDACFDCENHIKNLDLIFQRL
GI
Download sequence
Identical sequences K9SWW0
gi|428222224|ref|YP_007106394.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]