SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428222307|ref|YP_007106477.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428222307|ref|YP_007106477.1|
Domain Number 1 Region: 2-228
Classification Level Classification E-value
Superfamily Hsp33 domain 2.35e-55
Family Hsp33 domain 0.0000105
Further Details:      
 
Domain Number 2 Region: 218-275
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 2.09e-18
Family HSP33 redox switch-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428222307|ref|YP_007106477.1|
Sequence length 285
Comment disulfide bond chaperone [Synechococcus sp. PCC 7502]
Sequence
MRATAANGGIKAVAVTTTNLTAEARRRHKMSKITTKALGQTMTAALLLASGMKQPQARVS
IRINSDGDLGLVFADAGFDGTVRGYVDQPQLESAVLGQNGSLQVIRDVGYGNPYSGNVEI
VSSEVSENITYYLVSSEQIPSALLTGVLTDDRGVDVAGGLLLQIMPQARRDHNLLEVLDS
RVRSLSEFTSLLKQGMSLRQILEDLLGDIELNILPEVQPVKFKCRCTFDRVLGALRMFGV
EELRDMINEDHGAEAICQFCSEVYRADRFDLEKIILNLQASSQSS
Download sequence
Identical sequences K9SUQ8
gi|428222307|ref|YP_007106477.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]