SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428222404|ref|YP_007106574.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428222404|ref|YP_007106574.1|
Domain Number 1 Region: 2-123
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.03e-53
Family Cold shock DNA-binding domain-like 0.000004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428222404|ref|YP_007106574.1|
Sequence length 137
Comment 30S ribosomal protein S12 [Synechococcus sp. PCC 7502]
Sequence
MPTIQQLIRTERQNANQKTKSPALKSCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSG
FEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTAGVKGRMQGRSKYGAK
RPKPGQAAAVPTKGKKK
Download sequence
Identical sequences K9SXA8
WP_015169094.1.58188 gi|428222404|ref|YP_007106574.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]