SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428222492|ref|YP_007106662.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|428222492|ref|YP_007106662.1|
Domain Number - Region: 197-403
Classification Level Classification E-value
Superfamily PP2C-like 0.000196
Family PP2C-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428222492|ref|YP_007106662.1|
Sequence length 405
Comment serine phosphatase RsbU, regulator of sigma subunit [Synechococcus sp. PCC 7502]
Sequence
MDVNMNAVSVNISGRQRMLSQRIAMFALRLASPEYITEQQAVREQLSNLADLMGKAHRGL
IYGDASMGLQGNPSQSLQKIYFGEPLFVDRQVCDFISAVRSLISCPASELQANNPYLRTI
VTAAGTKLLNALEAVVAQYQKESEEIQALYEQIKAENLRFSTELNISRQLQQMILPKTDE
LCQNPELEIVGFMEPAEKVGGDYYDVLHQGGRVKIGIGDVTGHGLESGTIMLMVQTTVRA
LLNANINDPAVFLHALNQTLYGNIQRMATSKSMTLSLIDYDHGKVTVSGQHEMLLLVRQN
GKIELFDTIDLGFPIGMEEDIRPFLSESSMYMEAGDLLAVYTDGITEAENSNRELYGLER
LCHLLQQHRHLSANEIQNLIIADVRSHIGKHRIYDDITLVILKKK
Download sequence
Identical sequences K9SV70
WP_015169182.1.58188 gi|428222492|ref|YP_007106662.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]