SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428222518|ref|YP_007106688.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428222518|ref|YP_007106688.1|
Domain Number 1 Region: 1-233
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 5.77e-44
Family Protein serine/threonine phosphatase 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428222518|ref|YP_007106688.1|
Sequence length 248
Comment Calcineurin-like phosphoesterase [Synechococcus sp. PCC 7502]
Sequence
MSRYVIGDVHGQFDGLMLLLNQINLTADDQLFFLGDLIDRGAQSADVVDWVIKNQHSCIL
GNHEQMCIEAFSYPNSSAVWQGWLINGGSRTLESYSSSEMLEAHLEWMQNLPLYLDLGDF
WLVHAGLNPKLEINAQSSTEFCWIREPFHRSKEPYFANKTIITGHTITFVFPGLNAGDIA
QGAGWLGIDTGAYHPKSGWLTALNIDTSTVYQINTFTNAVRSLPLSEVSVSVLDKSGNKS
KRRLVNSY
Download sequence
Identical sequences K9SWH5
gi|428222518|ref|YP_007106688.1| WP_015169208.1.58188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]