SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428222541|ref|YP_007106711.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428222541|ref|YP_007106711.1|
Domain Number 1 Region: 1-123
Classification Level Classification E-value
Superfamily CheY-like 3.13e-40
Family CheY-related 0.00016
Further Details:      
 
Domain Number 2 Region: 133-230
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 1.36e-23
Family PhoB-like 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428222541|ref|YP_007106711.1|
Sequence length 231
Comment response regulator with CheY-like receiver domain and winged-helix DNA-binding domain [Synechococcus sp. PCC 7502]
Sequence
MRLLLVDDEEELTKPLQRLLINQGYAVDVATDGKTGWQLAQTQTYDLLILDWVMPIMSGV
ELCRSLRQTGDHTPVLFLSAKDTLDERVEGLDSGADDYLVKPFELKELLARIRALLRRTS
LSSGESLEASSEKSEPQTLVFANLELDINSQVLYRDRQSIPLSEKECQLLAYFMQHPNQL
LTHDQIQHHIWHEDIPTNTLVAQIRLLRRKIDQDSENSLINTVYGKGYRFG
Download sequence
Identical sequences K9SX99
gi|428222541|ref|YP_007106711.1| WP_015169231.1.58188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]