SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428222589|ref|YP_007106759.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428222589|ref|YP_007106759.1|
Domain Number 1 Region: 187-642
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.74e-113
Family Amylase, catalytic domain 0.00000000527
Further Details:      
 
Domain Number 2 Region: 650-752
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.75e-36
Family alpha-Amylases, C-terminal beta-sheet domain 0.00031
Further Details:      
 
Domain Number 3 Region: 15-122
Classification Level Classification E-value
Superfamily E set domains 8.92e-17
Family E-set domains of sugar-utilizing enzymes 0.0045
Further Details:      
 
Domain Number 4 Region: 146-202
Classification Level Classification E-value
Superfamily E set domains 0.00000000217
Family E-set domains of sugar-utilizing enzymes 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428222589|ref|YP_007106759.1|
Sequence length 757
Comment alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase [Synechococcus sp. PCC 7502]
Sequence
MIATISTEQIDLIVKNLHQDPFAILGSHQIEQEGQLVWVIRAYLPEAEAVTVVDPENHRQ
YPMTAVHHPHFFECLIPEAPSLFSYKLKVTEWVDGKKCDRLIYDPYAFKSPLISDFDRHL
FAQGTHYQVYEKLGAHPTQIDGVEGVYFAVWAPNARNVSVLGDFNYWDGRKHQMRKSESG
VWDLFIPDIGVGYSYKFEIKNQAGHIYEKSDPFGFQQEIRPKTASVVNDLKYEWQDQAWM
EQRRNSNPLNRPISVYEVHLGSWMHGSFETPPTDAYPMVSAADLKPGARFLTYRELADKL
ISYVKDLGFTHIELLPVAEHPFDGSWGYQVIGHYAATSRYGTPQDLMYFIDRCHEANIGV
LLDWVPGHFPKDGHGLALFDGTHLYEHADPRIGEHKGWGTLIFNYTRNEVRNYLIANALF
WFDKYHIDGIRVDAVASMLYLDYCREEGEWLRNEYGGRENLGAIEFFRHLHSILFSYFPG
VLSIAEESTAFPLVSHPAYLGGLGFNLKWNMGWMHDMLDYFSMDPWFRQFHQNSVTFSIM
YAFSENFVLALSHDEVVHLKKSLLAKMPGDDWQKFANQRCLFGYMFTHPGKKTLFMGMEF
GVWKEWNVWGDLEWDLLNYPLHQNLQKFVKDINHLVQTESALHAQDFSEQGFQWIDCSDR
SNSIVAFIRKDQKGEFVVVVCNFTPVAHSKYRVGVPLHGFYQEILNSDATIYGGSGLGNL
GGKWSDQSYYWHNQPHSLEVCVPPLATVVFKFIHAKA
Download sequence
Identical sequences K9SXU8
gi|428222589|ref|YP_007106759.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]