SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428222590|ref|YP_007106760.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428222590|ref|YP_007106760.1|
Domain Number 1 Region: 371-574
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.61e-64
Family Pyruvate oxidase and decarboxylase PP module 0.0000156
Further Details:      
 
Domain Number 2 Region: 3-182
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.24e-63
Family Pyruvate oxidase and decarboxylase Pyr module 0.00000354
Further Details:      
 
Domain Number 3 Region: 198-361
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 3.74e-63
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000473
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428222590|ref|YP_007106760.1|
Sequence length 583
Comment acetolactate synthase large subunit [Synechococcus sp. PCC 7502]
Sequence
MLQSGAFALIDSIKRQGVQHLFGYPGGAILPVYDEIYKAEGRGDLKHILVRHEQAAVHAA
DGYARATGKVGVCIATSGPGATNLVTGIATAQMDSIPLVIITGQVPSYAIGTDAFQETDI
FGITLPIVKHSYVVRRPEDIARIVAEAFHIAGTGRPGPVLIDIPKDIAQTQFEYVPKLEV
HLRGYKEQTLPSDIAIAVEKSIELIRKAHRPLLYVGGGAIIANAFAEIKQLAERFQIPVT
TTLMGKGIFDENHPLALGMLGMHGSAYANYAVQGCDLLIAVGARFDDRVTGRLDKFAPEA
KVIHIDIDPAEVGKNRLPEVPIVGDVRQVVTELLNATAYKEEIMTKTWLDQISLWKEDYP
LIAPHYPDIFSPQEVIYEFGRQAPEAFFTTDVGQHQMWSAQFLKNTPRHWISSAGLGTMG
YGMPAAMGVKIAFPNDQVICISGDASFQMNLQELATLAQYDIKVKVIIINNSWQGMVRQW
QEAFYSERYASSNMEVGMPDFVKLADAFGVQGMLVQHGDDLQAVVAEILASDRPVLADFR
VKRNENCYPMVSPGKSNSEMEGLPEPKRIRSALERELGLGTRA
Download sequence
Identical sequences K9SWS8
WP_015169280.1.58188 gi|428222590|ref|YP_007106760.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]