SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428222670|ref|YP_007106840.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428222670|ref|YP_007106840.1|
Domain Number 1 Region: 637-737
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.000000000533
Family Histidine kinase 0.013
Further Details:      
 
Domain Number 2 Region: 290-341
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00000000536
Family HAMP domain 0.004
Further Details:      
 
Domain Number 3 Region: 391-595
Classification Level Classification E-value
Superfamily PP2C-like 0.0000000131
Family PP2C-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428222670|ref|YP_007106840.1|
Sequence length 747
Comment HAMP domain-containing protein,histidine kinase [Synechococcus sp. PCC 7502]
Sequence
MTKFTFPSFQFKSITYRLIFGCVVAAIAIYGLSYTSARLIIQSVVEKWMLDIAQSRIDTI
TKEIEGELKAIEHSTLILSQIKSNNDLRQSLKVLADNQPKVQAIALINTNNINNLGWQYQ
RQKGYTKLNEQEQLLWQNQCLFNKKEEHKLQPHWTAPHPLLNSQLSGVTYCVPITSGILA
MEVNLDWITPLMQKYLTQPDEVNFLKLGETFVISPSNQWIVKPTTQIQNKTQNDLFKQIS
QQVPSVNWKVGVAFSNSELERFLQHYLWLAIASMSRDMVLMWVVIAMISRLTTRSLRALI
DSTEAMAHGDLDTKLPPVTSVDEVGRLTQAFGRMQSSLLTHIQDLQETTAAKQKLESEIT
LAAEIQRTMLPRPSILGIPNAPYEISALLKPARIVGGDLYDFFLLGSDRLCLIIGDVAGK
GFPAALMMACTVTLIRALTKTSSTPAEILHNVNRELCVDNNECQFVTLFCGVLDLHSGRF
IYASAGHDAPLLIKNQQVTCLDLDTGSPLGLYEDAIFTQSECLLESNDLILLYTDGITEA
MNSKGEIFTDERLIETIKFHLPSNPTRTIRTVQHFCDRFVGEAPQSDDMTLLVLQYLPLH
PLLQENIMEWSLSINSELTDIEKLRQNLSQILAAAALTMESIEDAQLIAEEVVVNIIQYG
YANSQGGHIDLQLELDAERLTMTFIDGGKPFNPITEIAAPDLNGDDDRRSQGGLGFFLVQ
QLSEKVNYIHENGKNILTVCQLIAKIP
Download sequence
Identical sequences K9SX09
WP_015169357.1.58188 gi|428222670|ref|YP_007106840.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]