SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428222725|ref|YP_007106895.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|428222725|ref|YP_007106895.1|
Domain Number - Region: 3-116
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.000847
Family The homologous-pairing domain of Rad52 recombinase 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428222725|ref|YP_007106895.1|
Sequence length 146
Comment hypothetical protein Syn7502_02823 [Synechococcus sp. PCC 7502]
Sequence
MTITEITEKLKQPFPAADHEIRELPGGKQWVYIRWQKIRSRLHQACPDWQVSYSDPNYLD
EYCYVRCKLTIAGISREAVGNAKIQQLSSKGNDMSRGTPIERAIADAFKNAAESFGVGAY
LDDQEFVIRHLCKEGDMRWHKLKQKM
Download sequence
Identical sequences K9SX90
WP_015169412.1.58188 gi|428222725|ref|YP_007106895.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]