SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428222893|ref|YP_007107063.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428222893|ref|YP_007107063.1|
Domain Number 1 Region: 74-423
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.24e-75
Family Extended AAA-ATPase domain 0.0000000123
Further Details:      
 
Domain Number 2 Region: 9-44
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000171
Family ClpX chaperone zinc binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428222893|ref|YP_007107063.1|
Sequence length 441
Comment endopeptidase Clp ATP-binding regulatory subunit ClpX [Synechococcus sp. PCC 7502]
Sequence
MPSKYDSHLKCSFCGKSQEQVRKLIAGPGVYICDECVDLCNEILDEELFNAPALQNRKDA
APEKRKKTASISLNQIPKPREIKKYLDENVIGQDEAKKVLSVAVYNHYKRLSFLEPDGHG
KNPDDTVELQKSNILLIGPTGCGKTLLAQTLAEMLEVPFAVADATTLTEAGYVGEDVENI
LLRLLQVADLDVEEAQRGIIYIDEIDKISRKSENTSITRDVSGEGVQQALLKMLEGTIAN
VPPQGGRKHPYQDCIQIDTKNILFICGGAFVGLDKAIEQRIGKKSMGFIQQGEIIPKEKR
TADILRQTQPEDLVKFGMIPEFIGRIPVTAVVNPLDEDALAEILTEPRSALVKQYQKLLK
MDNVQLEFQPDAIRAIAQEAYRRKTGARALRGIVEQLMLDVMYELPSRNDVKRCVVTREM
VEKLSTAEIIFISSNIKSESA
Download sequence
Identical sequences K9SXL3
WP_015169579.1.58188 gi|428222893|ref|YP_007107063.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]