SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428222911|ref|YP_007107081.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428222911|ref|YP_007107081.1|
Domain Number 1 Region: 138-190,217-362
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 4.97e-51
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000184
Further Details:      
 
Domain Number 2 Region: 446-589
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.57e-35
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000748
Further Details:      
 
Domain Number 3 Region: 2-137
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.78e-27
Family Duplicated SiR/NiR-like domains 1 and 3 0.0078
Further Details:      
 
Domain Number 4 Region: 363-440
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 0.00000000000000411
Family Duplicated SiR/NiR-like domains 1 and 3 0.0024
Further Details:      
 
Weak hits

Sequence:  gi|428222911|ref|YP_007107081.1|
Domain Number - Region: 596-641
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.018
Family CopG-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428222911|ref|YP_007107081.1|
Sequence length 643
Comment sulfite reductase (ferredoxin) [Synechococcus sp. PCC 7502]
Sequence
MTNTIKYSKVEVLKEKSNYLRFPISSELTDGNSFFSQDGIQILKFHGSYQQKDRDLEKAK
AKGEESNYSMMLRTRSPGGFIPWQLYLALDQLSDRYGNHTLRATTRQGFQIHGILKQDLK
TVIADITQNMGSTVGACGDINRNVMAPVAPYKNRPEYQIARDYAVKIADLLAPQAGSYYD
LWLDGEVAVSSLPIEAAEVTKARSQHGKGKIDTNTTDSSEPIYGTQFMPRKFKIAIAVPG
DNSVDLFTNDLSLVVITDGNQKLEGFNVYVGGGLGRSHNNDATIVRLADSIGFVPVSDIY
ELVKAVVAVQRDHGDRYNRRHARFKYLLHEWGVEKFKQVLLDYYPTPLQAPKPLPEWKYE
DYLGWNEQGDGKYFLGISIENGRVIDKESLQLKTALREITEAFHLPIYLTPNHNLLFTEI
PAIAKTDIQGILDRCGVLSPDQIDPLTRYSMACPAFPTCGLAITESERALPSIIERLRVL
LDRMGLGDEKLITRMTGCPNGCARPYMAELGFVGSAWNEYQVWLGGNFNSTRLAQPFIQR
LHVDKLEEFFEPLFAYFKRDRLDQNEGFGDFCDRIGFDQLREFSTNYVRQDISPATAKAK
DQRHRITLSTSVYEQLKSVSSSHNKSMKELVEAAIANYLSSLN
Download sequence
Identical sequences K9SYD9
gi|428222911|ref|YP_007107081.1| WP_015169597.1.58188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]