SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428222947|ref|YP_007107117.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428222947|ref|YP_007107117.1|
Domain Number 1 Region: 15-233
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 9.18e-57
Family PP-loop ATPase 0.00043
Further Details:      
 
Domain Number 2 Region: 212-310
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 3.4e-16
Family MesJ substrate recognition domain-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428222947|ref|YP_007107117.1|
Sequence length 318
Comment tRNA(Ile)-lysidine synthetase [Synechococcus sp. PCC 7502]
Sequence
MLRKILRVKLNRVIPQLLPKSSHILIAVSGGQDSLCLAQLLIFAQIKWQWQLAIAHCDHR
WRLDSRDNALHVQKLATDWGVPFYLRTAKIQIESEAKAREWRYQMLAEMAREANCQVVVT
GHTASDRAETLLYNLVRGSGTDGLQSLGWQRPLSSDMQLVRPLLNISRQETADFCQELKL
AIWEDSTNHSLCYKRNRIREELIPYLCQYFNPAVEKALSQTAELLSADVEYLEAQAHKFW
QEREPKINRVELQQQAKAIQRRAIHQFLSYFLLRSPDFSHVERLILLLSAPNRSHSSPLA
GGWQAEVEHPFIYLRQVN
Download sequence
Identical sequences K9SWH2
WP_015169633.1.58188 gi|428222947|ref|YP_007107117.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]