SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428222951|ref|YP_007107121.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428222951|ref|YP_007107121.1|
Domain Number 1 Region: 6-230
Classification Level Classification E-value
Superfamily Ribosomal protein S2 3.14e-96
Family Ribosomal protein S2 0.000000393
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428222951|ref|YP_007107121.1|
Sequence length 261
Comment 30S ribosomal protein S2 [Synechococcus sp. PCC 7502]
Sequence
MSVVSLAQLLESGVHFGHQTRRWNPKMEPYIFTERNGVHIIDLVQTAQYMEEAYAYMRNA
SEQGRKVLFVGTKRQAAGIVAQEALRCGSHFVNQRWLGGMLTNWTTIKTRIDRLKDLERR
DESGALDRLPKKEASMLRREMEKLQKYLGGLKAMRKIPDVVVIVDQKREYNAVQECQKLG
IPIVSILDTNCDPDTVDVPIPGNDDAIRSVKLIISKLADAIYEGRHGQVDEYDAVAADSD
YDPDAYVDDIADEVTEEDVSV
Download sequence
Identical sequences K9SYH6
WP_015169637.1.58188 gi|428222951|ref|YP_007107121.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]