SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428222961|ref|YP_007107131.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|428222961|ref|YP_007107131.1|
Domain Number - Region: 44-125
Classification Level Classification E-value
Superfamily E set domains 0.000168
Family Arrestin/Vps26-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428222961|ref|YP_007107131.1|
Sequence length 128
Comment hypothetical protein Syn7502_03098 [Synechococcus sp. PCC 7502]
Sequence
MLISIDFELETPEVELGQVVTGNFIWQGSTARKSISVDIAIGWCTQGKGYQDQDTVCHQV
FNEVEPDVIMPFAIALPLNAPPSYSGKLIKIMWKVTTTIYIQGFLGKFGNQKEEFSRPIK
VLPYRVVP
Download sequence
Identical sequences K9SYI6
WP_015169647.1.58188 gi|428222961|ref|YP_007107131.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]