SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428222976|ref|YP_007107146.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428222976|ref|YP_007107146.1|
Domain Number 1 Region: 142-480,509-584
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.58e-137
Family Amylase, catalytic domain 0.000000179
Further Details:      
 
Domain Number 2 Region: 20-151
Classification Level Classification E-value
Superfamily E set domains 1.85e-30
Family E-set domains of sugar-utilizing enzymes 0.0094
Further Details:      
 
Domain Number 3 Region: 598-704
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 2.66e-20
Family alpha-Amylases, C-terminal beta-sheet domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428222976|ref|YP_007107146.1|
Sequence length 705
Comment glycogen debranching protein GlgX [Synechococcus sp. PCC 7502]
Sequence
MERIDIHPTHSYESFKLRLGKPQPFGATIVPGGVNFSIFSSHATSCTLVLFKKHAKAPLA
EIPFPDEFRIGNVYCMVVFDLDYENLEYGYRMDGPNNFQQGHWFDPSKILLDPYAKIIGG
RDVWGVTPDWEDIYHHRGRIAFDDFDWGNDRALEIPPEDQIIYEMHVRSFTRHESSGIKK
NHRGTFAGIRDKIPYLKELGVNAVELMPVYEFDEFENSRPNPQTGETLYNYWGYSTVGFF
SPKAGYAATGKFGMQVDELKNLVKELHKNGIEVILDVVFNHTAEGNERGPTISFRGIDNK
TYYMMTPEGYYFNFSGCGNTINCNNPIVRNIVLDCLRYWAAEYHIDGFRFDLASILGRDP
WGYPLANPPLLESLAFDPILAKCKLIAEAWDAGGLYQVGSFPAYGRWAEWNGKYRDGIRK
FLKGDGTVGQIAQCLQGSPDLYAWAGRAPATSINFITAHDGFTLMDLVSYNHKHNEANGE
NNNDGSNDNDSWNCGWEGATDDVAINALRRRQIKNAIAMLMVSQGVPMLLMGDEVGRTQN
GNNNTYCHDNELSWLDWHLQTKNSDILDFVKHCIAFRRSHPVLRNPNHFRNQDYVGSGYA
DITWHGTKAWNADWSEENRAIAFMLCGKHAKGGTVEDNYIYVAMNMHWQTQWFEIPSLPQ
SLQWHIFANTGAIFPSSYLPGTEPVLDHQSGLLVGDRSVVILVGK
Download sequence
Identical sequences K9SYJ9
WP_015169662.1.58188 gi|428222976|ref|YP_007107146.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]