SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428223123|ref|YP_007107293.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428223123|ref|YP_007107293.1|
Domain Number 1 Region: 114-361
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.62e-44
Family D-glucarate dehydratase-like 0.0006
Further Details:      
 
Domain Number 2 Region: 6-124
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 0.00000000000000212
Family Enolase N-terminal domain-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428223123|ref|YP_007107293.1|
Sequence length 362
Comment o-succinylbenzoic acid synthetase [Synechococcus sp. PCC 7502]
Sequence
MSALIIKQINLEFFKLSLRQPIVTATSTIRERTGIVIEVIDQLHNRGLGESSPMAGFGME
PIIYTARSLKRMQRLLIGKAIASLEDIPNLLSLYNLPPAAKHGIELALLNLWASYHQTNL
AKLLHSHQRSEVAVNALIGQVSPELAAQKTQQLCELGYKCFKVKVGDPQDLQRVQAVRRT
VDEFSKTATTSEINTEIKIRIDANQAWTVVEAIAKLNSFSDLDIEYVEQPVSAQNLTEMA
EVCRNVSIAIAADESVKNIQVLEQIIAMQAADIVILKPMVLGGILTAQKIAKIAVGAGLD
VVFTTTLDGAIAQKGALQLAAMSEVHRACGVAPTELFVSYDTKINDLLTSTIPVIGGRIT
VI
Download sequence
Identical sequences K9SY90
WP_015169809.1.58188 gi|428223123|ref|YP_007107293.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]