SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428223281|ref|YP_007107451.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428223281|ref|YP_007107451.1|
Domain Number 1 Region: 5-277
Classification Level Classification E-value
Superfamily Folate-binding domain 3.48e-92
Family Aminomethyltransferase folate-binding domain 0.00000094
Further Details:      
 
Domain Number 2 Region: 271-360
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 4.25e-26
Family Aminomethyltransferase beta-barrel domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428223281|ref|YP_007107451.1|
Sequence length 361
Comment glycine cleavage system T protein [Synechococcus sp. PCC 7502]
Sequence
MTDLLKHTPLFDLHLDAKAKMVEFGGWQMPLQYQGIIAEHQAVRSSVGMFDVSHMGKFAI
AGKNALGSLQKLVPSNLARLKAGQAQYTALLNPEGGIIDDVIVYCHGGDHWSIIVNAATI
DKDRGWITDHLEDCEFSDRSSTQTLIAIQGKNALRYLQGIINTDLTQLKRFGHINTEVLS
KTSFVARTGYTGEDGFELMTDISVGQELWAKLIDAGVTPCGLGCRDTLRLEAGMHLYGQD
MNDQITPWEADLGWIIHLSEKAEFIGRSALETQLQSGISKQLVALEMQGKNIARHDYPIV
FVDEVVGVITSGTLSPTLGKPIALGYVPVYLAAIGQIVEVQIRNQTYPAQIVKRPFYKSS
K
Download sequence
Identical sequences K9SZJ3
gi|428223281|ref|YP_007107451.1| WP_015169967.1.58188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]