SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428223392|ref|YP_007083614.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|428223392|ref|YP_007083614.1|
Domain Number - Region: 16-47
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 0.00667
Family HSP33 redox switch-like 0.0095
Further Details:      
 
Domain Number - Region: 24-104
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0537
Family Cytochrome c3-like 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428223392|ref|YP_007083614.1|
Sequence length 130
Comment hypothetical protein Syn7502_03591 [Synechococcus sp. PCC 7502]
Sequence
MSMDRKLYPTDWEQIAIAIKEAVDWKCEKCGKQYRRNGESWAEFFSEWDMQSSEFAEAID
HPQRFTLTVAQLDHVQSNCGGTHPEGNRSNLKALCKPCHLRYDVGQMATKKRLKKERHGQ
LTLEVTNGSS
Download sequence
Identical sequences K9SZT9
gi|428223392|ref|YP_007083614.1|NC_019691 gi|428223392|ref|YP_007083614.1| WP_015146344.1.58188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]