SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428223439|ref|YP_007083661.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428223439|ref|YP_007083661.1|
Domain Number 1 Region: 1-54
Classification Level Classification E-value
Superfamily Rubredoxin-like 5.55e-22
Family Rubredoxin 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428223439|ref|YP_007083661.1|
Sequence length 65
Comment rubredoxin [Synechococcus sp. PCC 7502]
Sequence
MEKYICKTCGYVYDPALGDPDSGIEPGIPFGALPDDWVCPKCGTPKADFEPEDTPATDVP
LMEPV
Download sequence
Identical sequences K9SZ63
gi|428223439|ref|YP_007083661.1|NC_019691 WP_015146391.1.58188 gi|428223439|ref|YP_007083661.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]