SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428223447|ref|YP_007083669.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428223447|ref|YP_007083669.1|
Domain Number 1 Region: 2-133
Classification Level Classification E-value
Superfamily CheY-like 9.39e-40
Family CheY-related 0.00062
Further Details:      
 
Domain Number 2 Region: 258-382
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.26e-21
Family Histidine kinase 0.012
Further Details:      
 
Domain Number 3 Region: 148-214
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000000647
Family Homodimeric domain of signal transducing histidine kinase 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428223447|ref|YP_007083669.1|
Sequence length 385
Comment response regulator with CheY-like receiver domain and winged-helix DNA-binding domain [Synechococcus sp. PCC 7502]
Sequence
MNKPSILVVDDEPNNFDVIETFLSNQDYQLHYVASGKEAITSLDLLQPHLILLDVMMPGM
DGLQVCKEIKAMPQWSNVPIIMATALTDKKDLAQALFVGADDFISKPINRLELMARVHSM
LRIKNQYDRIQSFSNLQRNTIALLTDNLQAVRGNIASSLPHELNTPLCGILSGIQFLIDG
IDDMGSEEIHEWLDISYQSALRLEKLTQKFLNYLFLELVLTLPQEEGTAKDTANKSNNSS
RSIFIQDFAATIAQECHRLEDLVCQIEDVELSVPSSHLQWIVNELLENAFKFSELKTLVT
VRGEGKDGMFHLWISDRGRGMTETQIATLGAFMQFERQIYEQQGMGLGLKIAEKAVKLYG
GRFLITSICNQETTVYLTLPLKNLI
Download sequence
Identical sequences K9SZZ0
gi|428223447|ref|YP_007083669.1| WP_015146399.1.58188 gi|428223447|ref|YP_007083669.1|NC_019691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]