SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428221705|ref|YP_007105875.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428221705|ref|YP_007105875.1|
Domain Number 1 Region: 184-327
Classification Level Classification E-value
Superfamily CheY-like 1.37e-41
Family CheY-related 0.0013
Further Details:      
 
Domain Number 2 Region: 359-593
Classification Level Classification E-value
Superfamily PP2C-like 0.00000000628
Family PP2C-like 0.014
Further Details:      
 
Domain Number 3 Region: 16-75
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000314
Family Homodimeric domain of signal transducing histidine kinase 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428221705|ref|YP_007105875.1|
Sequence length 595
Comment serine phosphatase RsbU, regulator of sigma subunit [Synechococcus sp. PCC 7502]
Sequence
MDNIFSEFSQDHNLSGLIIKLRHDFRTPINAIIGYSEMLLEDLETEDNEIISGFQKINVG
GHELLSIVNQNLDNSLEKSLKAILGLSPILEAVNIESNSSLQRVIENCQLLKNDQSLTSL
IPDIERIEVSAFRFRELLNKCLQAALTASELQSIDPNNQSVNNLVKEISHDLLKKNHFIE
NQTCHLLVVDDNENNRDLFTRQLQREGYIVTTATNGQEALTMIKTGEYELVLLDLMMPIL
DGYQALKMLKADEQWQHIPVIMISASDEIDQVVRCIEIGAEDFLPKPFNPILLKARIGAA
LDKKRFRDRERQYLQQVEIYSQKLNQELEKGRQMQLNFLPPELLQVPNWEISAFFKPARQ
VAGDFYDTFPVLEKYVGLVIADVCDKGVGAALFMALFRSLIRIFASQTAMRNFYQHLTLD
SSGKSEKLTDSSYIAELTPTNVLEAVALTNNYVAEYHGDLGMFATLFFGVLDPQTGILYY
INGGHEPLFIINSEGKIEQKLNSTGPAVGMMPNMKFRVEQAQLQAGDILIGYTDGVPEAR
AFGGEFFTDQKLLNILTKPISSVSQLLTEITENVINHIGEADQFDDITLLAIQRN
Download sequence
Identical sequences K9SUA3
gi|428221705|ref|YP_007105875.1| WP_015168397.1.58188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]