SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428223206|ref|YP_007107376.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428223206|ref|YP_007107376.1|
Domain Number 1 Region: 1-157,492-528,710-790
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.99e-26
Family ABC transporter ATPase domain-like 0.0058
Further Details:      
 
Domain Number 2 Region: 545-792
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000105
Family ABC transporter ATPase domain-like 0.0019
Further Details:      
 
Domain Number 3 Region: 367-456
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.0000000458
Family Rad50 coiled-coil Zn hook 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428223206|ref|YP_007107376.1|
Sequence length 806
Comment DNA repair ATPase [Synechococcus sp. PCC 7502]
Sequence
MRLISLYLENFRQHKSTQIHFPTGLIGILGENGSGKTTILEAIAWALYGKITRGDNDSVI
WRMAEGKSTAVAELTFAFNGQTLKVKRSQSSSKSNAELTQNQKIVATSTKAVNEKILELL
AMTHQEFFNSYFTGQKDLNFLGSIKGAVERERFIAKMLGYEKISEVQGAAGKEGTIRFDL
RQQERTVDRLQGALGDQVQIEDAIILYQNQLTEANHQLAEVTAALTLAIAHAAQLEPQLN
QLQQQRDQHYQLTAQVQNYQTQQARLIKEISQKIEQRSQIYTATQIYETLAVEVANYQAM
ETELAALTNVKQEFTKKTDLELRLTHLNQELQSLEQDLDLLKDIDISHIRQAIAHSQAQL
EHINLEIQTQTQTWQTTQAELKAKIKTEQQNLSKLANQQQVILAAGVEGICPTCERPLHS
EYENVVEGFTSQLDHLRSHLKTWENELADLKQTPVALKSLQQTQTQIADLIKQQQQEELK
ISTDLTRFQLLQNQQNAKTQEIKQLQVQISHLPHSFDLDRYNHLSSQIQSLKPKYEQYLR
SQGISQRLHEIDGELVNLNQEQSQLQNLLSKLEQEIQQLKFKESEYSDLKQAIATANQNL
DRIRTQQAQAQQQQALITQALTTAQKQADEYRLKQAEYQTAKKEQILLQELDNAFTDMRQ
HFTEEIRPQLADAASIFLNQLTDGRYNTIEIDSKYNVIVLADGDRKPVISGGEEDIVNLS
LRLAISQMITERSGQPFSLLILDEVFGSLDDGRRNNVLALLNALEQQFEQVLIISHLDSI
KDNLNHTIRLEFNAKEQCSQVADSLV
Download sequence
Identical sequences K9SZ96
gi|428223206|ref|YP_007107376.1| WP_015169892.1.58188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]