SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|334143312|ref|YP_004536468.1| from Thioalkalimicrobium cyclicum ALM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|334143312|ref|YP_004536468.1|
Domain Number 1 Region: 3-278
Classification Level Classification E-value
Superfamily Carbamate kinase-like 6.42e-45
Family N-acetyl-l-glutamate kinase 0.00078
Further Details:      
 
Domain Number 2 Region: 265-399
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 8.18e-21
Family N-acetyl transferase, NAT 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|334143312|ref|YP_004536468.1|
Sequence length 427
Comment amino-acid N-acetyltransferase [Thioalkalimicrobium cyclicum ALM1]
Sequence
MKQSELDFLNNLRQASDYVAQHRGKVCVVYLPGELLEHREQLQEFAEDISHLNALGLRLI
IVMGATLQINQALEQANIVWSSHHQIRITSPEMLPILQRTIGEVRSMLEAAFSRQQTHHP
FPLTLCSGNWVIAKPRGVIDGIDYQHTGLIRKINQTALQAILDSNQIALLTPLAYSLTGE
VFNLNTLEQACWVASKIKADKLMVFTSSDQMADLPKQLSLAQLSHWQAKNTDQADLIQCL
TNNAQQVKRIHLLNESDPTSLLIELYSRDGIGSLVFTDRYHEIRQARIEDVSGIIDLISP
LEQKGMLVKRSRERLELEINQFFVIERDSHILGCAALYHHSGSQAELACLAIDPNYQGQG
LGEELINFLSLKAKEQAITQLFLLTTHTYHWFIEQGFVLASLDELPPPKQQLYNFQRQSK
VLIKALT
Download sequence
Identical sequences F6D9V2
gi|334143312|ref|YP_004536468.1| WP_013834772.1.4001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]