SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|334143327|ref|YP_004536483.1| from Thioalkalimicrobium cyclicum ALM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|334143327|ref|YP_004536483.1|
Domain Number 1 Region: 20-163
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.23e-31
Family N-acetyl transferase, NAT 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|334143327|ref|YP_004536483.1|
Sequence length 165
Comment ribosomal-protein-alanine acetyltransferase [Thioalkalimicrobium cyclicum ALM1]
Sequence
MVQPQVYVDLTSPLNLVEGLHITPMFKDDLDAVVELEQQNAVAPWRLRSFELALNAKHCN
WVICSEAELIGFICASQVLDELHILNLSVAQTHRGQGLATAMIKHLCTIHQDVPIRMIFL
EVRESNKPAQKLYRKLGFKLDGVRKGYYQCARGIREDALLMSREF
Download sequence
Identical sequences F6D9W7
gi|334143327|ref|YP_004536483.1| WP_013834787.1.4001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]