SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|334143969|ref|YP_004537125.1| from Thioalkalimicrobium cyclicum ALM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|334143969|ref|YP_004537125.1|
Domain Number 1 Region: 23-237
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 6.36e-81
Family LFTR-like 0.00000441
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|334143969|ref|YP_004537125.1|
Sequence length 262
Comment leucyl/phenylalanyl-tRNA--protein transferase [Thioalkalimicrobium cyclicum ALM1]
Sequence
MSTPLRTLDTHLPSWLDPQCLAQGLNPFPPTTHCFDDPPGLLALSDRITPALLRQAYPQG
IFPWSAEDEPVTWWSPEPRAVLYTDQIKIRRSLKQAWRQQPWQITFNHALAQVLNHCASC
PRPGQDGTWLRQDLQHSLLELHQQSYVHSVEVWRDDQLVGGLYGLSFGQMFFGESMFSLV
PNASKLALVALTVHLQDWGWPMIDCQVTSDHLMSMGAVELARPDFEAQLQHQVTLRQRPQ
QDWIINPNLLAKALGHKDADHA
Download sequence
Identical sequences F6DCR0
WP_013835424.1.4001 gi|334143969|ref|YP_004537125.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]