SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333900013|ref|YP_004473886.1| from Pseudomonas fulva 12-X

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333900013|ref|YP_004473886.1|
Domain Number 1 Region: 3-363
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 3.95e-112
Family FMN-linked oxidoreductases 0.00000000177
Further Details:      
 
Domain Number 2 Region: 334-523
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 5.89e-41
Family N-terminal domain of adrenodoxin reductase-like 0.00000935
Further Details:      
 
Domain Number 3 Region: 464-521,559-654
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.96e-20
Family C-terminal domain of adrenodoxin reductase-like 0.0000702
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|333900013|ref|YP_004473886.1|
Sequence length 676
Comment 2,4-dienoyl-CoA reductase [Pseudomonas fulva 12-X]
Sequence
MTAYPHLLAPLDLGFVTLKNRTLMGSMHTGLEEKPGGFERMAAYFAERARGGVGLMVTGG
IAPNEEGGVYAGAAKLSTTEEADKHRIVTEAVHAEGGVICMQILHAGRYAYSPKQVAPSA
IQAPINPFKPQELDEAGIEKQIADFVNCSSLAQQAGYDGVEIMGSEGYFINQFLVTHTNQ
RTDRWGGSFANRMRLPVEIVRRVREAVGSDFIIIYRLSMLDLVEGGSTWDEIVTLAKAIE
AAGATIINTGIGWHEARIPTIATKVPRAAFTKVTAKLKGEVSIPLCTTNRINTPEVAEQV
LAEGDADMVSMARPFLADPEFVNKAAAGRADEINTCIGCNQACLDHTFGGKLTTCLVNPR
ACYETELNYIPTTAVKKIAVVGAGPAGLAAATVAAERGHSVTLFDAASEIGGQFNVAKRI
PGKEEFFETLRYFKRKLETTGVDVRLNTRVSASELIDGGFDEILLATGIVPRTPAIPGVE
HAKVISYLDAILQRKPVGPRVAVIGAGGIGFDVSEFITHAGPDTSLDREAFWKEWGIDLA
LEARGGIAGVQPQVEPAARQVFLLQRKKSKVGDGLGKTTGWIHRAGLKNKQVQMINAVEY
LQIDDQGLHIRVGEGEPQVLPVDTVILCAGQEPLRELQDALVAAGQSVHLIGGADVAAEL
DAKRAINQGSRLAAEL
Download sequence
Identical sequences F6AK78
gi|333900013|ref|YP_004473886.1| WP_013790923.1.13474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]