SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333898599|ref|YP_004472472.1| from Pseudomonas fulva 12-X

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333898599|ref|YP_004472472.1|
Domain Number 1 Region: 3-151
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 6.18e-37
Family N-acetyl transferase, NAT 0.00000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|333898599|ref|YP_004472472.1|
Sequence length 159
Comment diamine N-acetyltransferase [Pseudomonas fulva 12-X]
Sequence
MTLNIRPAVREDAALILRFITDLAIYEKAEHEVKTDVAGIENSLFGEGSTAHGLICELNG
EPMGYAVYFFNYSTWLGKHGLYLEDLYITPQQRGVGAGKALLRHLAKLAVARGCGRFEWS
VLDWNTPAIEFYDSIGAKPQNEWIGYRLTGEALTSFAAG
Download sequence
Identical sequences F6AGP9
gi|333898599|ref|YP_004472472.1| WP_013789520.1.13474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]