SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333898913|ref|YP_004472786.1| from Pseudomonas fulva 12-X

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333898913|ref|YP_004472786.1|
Domain Number 1 Region: 224-268,300-326,418-619
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 6.58e-45
Family CoA transferase alpha subunit-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|333898913|ref|YP_004472786.1|
Sequence length 710
Comment acetyl-CoA hydrolase-like protein [Pseudomonas fulva 12-X]
Sequence
MPQSRSLEQAVDHVLDAIDGPIHLGLPLGLGKPNRWVNALYARLREMPERELTIYTALCL
GRPRADQELQRRFLEPFVERVYGDYLELDFLADLQADKLPPNVRIEQFFLQPGSLLDSAP
TQQDYTSSNYSHAARDLNAKGVNVVAQLVAVDPARPQHFSLSCNPDITLDLLPMLQERRG
RGETILCLAQVHEELPYMAGDAELPREVFDIQLREHETSTLFSTPNMPVTVQDHCIGLYA
STLVRDGGSLQIGIGAMGDAVCAALLQRHADNPAYRAALDDLQGDQVHPLSSKLGDLESF
QTGLYGCSEMFVNGLLDLVEAGVIRRVVYPDVRVQRLASAGALDANGQPRSIQAMLDAGL
PARLDEAALAWMQEGGLLDANLKMQGENLLLPTDQQCSTDLSDPLSQAALRDYLAPARHG
VVVHGGFFLGPQSFYERLNAMSARQRSRFGMTGIGFINELYGQEELKRLHRVDARFINSA
FTVTLLGAAVADQLEDGRVLSGVGGQYNFVAQGHALPGARSILLLRSWRESAGEVRSNIV
WEYGHVTIPRHLRDVVITEYGIADLRGKTDSQVIEALLAVTDSRFQNELMVQAIEAGKLS
KDFRLDARYTSNTPERLEALAGRHRAVFAEYPLGSDFSEEEQALLRALTWLKGKFHLSEV
LELGKAAFDAPPAEAFPEALQRMGLERPEGLREELYQRLVLTGLEATRER
Download sequence
Identical sequences F6AK46
WP_013789824.1.13474 gi|333898913|ref|YP_004472786.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]