SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333899082|ref|YP_004472955.1| from Pseudomonas fulva 12-X

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333899082|ref|YP_004472955.1|
Domain Number 1 Region: 5-148
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 5.74e-35
Family N-acetyl transferase, NAT 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|333899082|ref|YP_004472955.1|
Sequence length 150
Comment ribosomal-protein-alanine acetyltransferase [Pseudomonas fulva 12-X]
Sequence
MSDAISFRRATEADIDAVLKIEYAAFSHPWTRGIFLDSLKSYEVWLMFEGSQQVGHGVIN
VIIDEAHLLNITVKPESQGRGLGLRLLEHLMARAAELKAGECFLEVRSSNQAAYRLYERY
GFNEIGRRRDYYPAPGGREDALVMACTLVE
Download sequence
Identical sequences A0A1Q9XT33 F6A9P7
WP_013789993.1.13474 WP_013789993.1.16258 WP_013789993.1.25077 WP_013789993.1.41730 WP_013789993.1.99970 gi|333899082|ref|YP_004472955.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]